DPCstruct | MC11049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 103 ± 6 aa |
| Standard deviation of domain lengths | 5.54 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 45.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0142 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0E9NAY1 | 96-196 | GFDPFIAYGAATVCIGGVGALLGPAIGEGLWWMTKGRHVKAQMQARQKEFYDRIKKHRVDASRQSFANPVPDYYGEKIASLKGYRQW… |
| A0A5B0PST1 | 2-110 | GIEAPYVYGLATLSCGLLGYLIGPSIGHAFFRLRVSKPTQRAMQDKNAQFYHHIKRHRVDPAQSIVNNPLPDWHGERIGSLKEYRKW… |
| A0A1R1XAZ5 | 88-191 | None |
| A0A1Y2G657 | 200-297 | None |
| A0A0J0XCK7 | 50-153 | None |
| A0A225B161 | 315-415 | None |
| A0A0F7SU31 | 133-237 | None |
| A0A168AX77 | 302-400 | None |
| A0A2W1EZG0 | 16-125 | None |
| A0A4Q2D4R1 | 2-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.