DPCstruct | MC11046
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 105 ± 3 aa |
| Standard deviation of domain lengths | 2.83 |
| Length coefficient of variation | 0.03 |
| Mean AlphaFold2 pLDDT confidence score | 90.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 52.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y2ETX7 | 128-225 | LIVDEVDDSRTTLSYAVAELQKDIDEHLAALTPEQRAATPPTELAIFVVHNKDQPKACSIPSHVRYFAGEDTKPKSWICYPWEQEDI… |
| A0A4Q4VP64 | 464-567 | NLVGKRILIVDEVDDTRTTLEYAVKELEKDIEAVRQKLDHGGEKTQFSIFVLHNKDKKKKGTLPPEMMAESRYVAARTVGDEWICYP… |
| A0A0G2DW26 | 228-331 | None |
| A0A401KJD4 | 567-671 | None |
| A0A094GMP6 | 556-661 | None |
| A0A5Q7YNS4 | 1-107 | None |
| A0A507DJ34 | 284-391 | None |
| A0A1Q3ES45 | 600-703 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.