DPCstruct | MC11045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 152 ± 14 aa |
| Standard deviation of domain lengths | 14.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A180H1S2 | 316-470 | QVESEIKFTATARILNAIIRDYGGFVTVGEGCKGKGPNGAWSDPDSISFCYPNKTMMNVIRQKHDHSVNTWYHGSVINSSYGFTAEY… |
| E3KRI6 | 60-215 | IKAAISVVARARLLAAVWKATNHFIIRGYKPCTQDGPNGALPDDDVFSYCSPDGIMMNVVQSHRGKLLQKFPSAHLLSPKYNLTTQY… |
| A0A2N5UZ10 | 440-587 | None |
| A0A2N5S1H4 | 440-585 | None |
| E3KRI8 | 210-370 | None |
| A0A0L6UKK9 | 346-517 | None |
| A0A5B0M875 | 197-360 | None |
| A0A0C4ERC0 | 118-270 | None |
| A0A2N5UG49 | 670-800 | None |
| A0A2N5SVU8 | 48-207 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.