DPCstruct | MC11042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 117 |
|---|---|
| Mean domain length (aa) | 265 ± 63 aa |
| Standard deviation of domain lengths | 63.49 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 30.68 |
| Pfam Score | 96.57 |
| Assigned Pfam label(s) | CL0010- PF17846- PF13966- CL0280 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B0P5E6 | 417-680 | VDAVHGILRDLQGNGTSQPETPTQIYTLDSCTEEILRKIKRTPGNWGMYGRKPPKQSDDDDFHAYRKQWKSNYYKNKMELQYNDSVQ… |
| A0A287SKA0 | 10-202 | RERYYAEKFREEAESKPIDQVQRDVVQKYVEGLCWVMRYYYQGVCSWQWFYPYHYAPFASDLKSLTEFEITFFLGQPFKPFDQLMGT… |
| A0A7S2SNR3 | 170-408 | None |
| C4M4B3 | 54-411 | None |
| A0A497P1P1 | 303-561 | None |
| A0A2G8LDA6 | 16-228 | None |
| A0A1Y2HX03 | 610-842 | None |
| L1LER9 | 776-1031 | None |
| K3W9G5 | 85-459 | None |
| A0A6V7PXW2 | 21-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.