DPCstruct | MC1104
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 166 ± 26 aa |
| Standard deviation of domain lengths | 25.85 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 78.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 21.02 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0F9HMQ9 | 21-149 | LANDRHPWDRQPKESDRAWAAFIVYRDLGIGRSIRAAVERLGKNKRYNGTAQQMSARYGWRIRVEAFDRERDRIRREEAEKVERELH… |
| A0A2G6QKU9 | 4-146 | SWERQPQETAKQYEYFSFYRDIGALRSFEKVREKYGKSESLITKISSKNNWVARVDAYDRYIDEIKRKQNIEAIKKANEINIGIAQQ… |
| A0A0F9C6F5 | 79-264 | None |
| A0A7J9TIH6 | 23-195 | None |
| A0A2A2D1A9 | 22-167 | None |
| R7NA15 | 1-146 | None |
| A0A0S7WMZ5 | 4-144 | None |
| A0A521KKD8 | 1-172 | None |
| A0A5Q3LAA2 | 3-203 | None |
| A0A0F9GAX0 | 12-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.