DPCstruct | MC11039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 563 ± 69 aa |
| Standard deviation of domain lengths | 69.39 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H6QQB1 | 450-987 | TARNPNVPIEENITVEAPSADESTKLEAGSLKGGTSSVNASKQGVTLLSKDTVDPSMQGTGENSKKTLQDQEMAGGLETKIINHDGS… |
| A0A5B0NNI8 | 81-678 | VHGEFPRENIKSNQKAKNLVAGNDNTDARKDHDRSHKLGILREDGILQKEGTKGNEEVVSDEKTNGITIEGNEDLTKKQEEEGRDDG… |
| F4RGY1 | 316-929 | None |
| F4RGR4 | 526-1069 | None |
| F4RBU8 | 1-559 | None |
| A0A180GD75 | 536-1073 | None |
| A0A2N5V802 | 184-858 | None |
| A0A0L6VM53 | 23-541 | None |
| E3JQ09 | 3-515 | None |
| A0A180GXM8 | 448-1058 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.