DPCstruct | MC11038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 89 ± 3 aa |
| Standard deviation of domain lengths | 3.16 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 61.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A9QY70 | 193-282 | IMPAANKGEFLKPGNPDLARALDLEICSKSDVFVPAIAGLFYGHVTGKRIASGRTQILVPAPWSSASAPASEFISTYISKKNHLVYS… |
| A0A438D8S8 | 1-89 | MPADKKPKFLDSETSEFMKVIDFYICSQSDVFVPAISGLFYANVAGKRIATGKNQILVPATISEATASASDFISSYISKKNHLAYSC… |
| A0A4S8JFL2 | 324-406 | None |
| A0A2G3D1E0 | 746-832 | None |
| A0A287RU17 | 107-196 | None |
| A0A438HGY7 | 441-530 | None |
| D7SQF3 | 130-222 | None |
| A0A0A9I3G1 | 221-308 | None |
| A0A2Z7A9N0 | 690-784 | None |
| A0A5A7QA49 | 320-406 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.