DPCstruct | MC11034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 193 ± 34 aa |
| Standard deviation of domain lengths | 33.64 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 68.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.68 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.43 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF09753- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438CZ80 | 28-202 | MGISRTEVNLRRLLAAAPQQQNQAKLIHYVATLREQLEQLTEERTLEGLPRVSKPKVNEYSEKIEAIASKITAPSSNVQVSQEPFSG… |
| A0A5E4FAV0 | 1-187 | MSISKTEVNLRRLLAAAPQQQNQSKLVHYVATLREQVEQLAEERTPEGLPRVSKAVLSDYSEKIEAIASKLAAPPPDIQAPKEPLAR… |
| A0A811NJE6 | 1-182 | None |
| A0A061FRV7 | 1-144 | None |
| A0A0D9XA65 | 1-180 | None |
| A0A7N0UIA0 | 1-159 | None |
| K3ZX21 | 1-177 | None |
| A0A4S4DM57 | 44-248 | None |
| A0A4P1RUI6 | 1-201 | None |
| A0A7G2EXP0 | 2-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.