DPCstruct | MC11033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 186 ± 18 aa |
| Standard deviation of domain lengths | 18.39 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 36.07 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0105- PF08326 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8QGB2 | 25-208 | LDPGCVIAKMQLDNPSKVQQAELHTGSLPRIQSTALRGEKLHRVFHYVLDNLVNVMNGYCLPDPFFSSRVKDWVERLMKTLRDPSLP… |
| A0A1D2MDF8 | 1-168 | MPVVGDKLNQVYQSCKTTLENVFNGYCLPDPYFSTKVKEIIEKFMKALRDPTLPLLELQEVISSISGRIPASVEKKIRKLMTLYASN… |
| A0A287MJX7 | 103-314 | None |
| A0A7E4S774 | 537-697 | None |
| A0A453GLR2 | 147-331 | None |
| A0A165WKM9 | 1-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.