DPCstruct | MC11032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 169 ± 23 aa |
| Standard deviation of domain lengths | 23.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 42.58 |
| Pfam Score | 98.33 |
| Assigned Pfam label(s) | CL0059- CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B1TRB5 | 2-152 | LGSIGYWYGSNQVHVPGASATVPYGPHELFSAVPSRSYFPRGFLWDEGFHNILIRKFDPELSLEILVSWLNTMSESGWIPREMILGV… |
| A0A438CMM8 | 49-189 | YNSTELLFSAEILKLAHMHIPVYIQLYFKSHDNFISYWPAELYTAVPSRSFFPRGFLWDEGFHQLLIWRWDIRICLDIIGHWLDLMN… |
| A0A6T6BQG1 | 168-366 | None |
| A0A183J7B6 | 204-408 | None |
| A0A427B787 | 2-174 | None |
| A0A3M6WA80 | 200-376 | None |
| A0A317A2Z7 | 6-193 | None |
| A0A0V0QP68 | 135-278 | None |
| A0A4U0XS39 | 488-656 | None |
| A0A061J5Y8 | 206-455 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.