DPCstruct | MC11031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 53 ± 1 aa |
| Standard deviation of domain lengths | 1.32 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 88.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 59.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0650 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803QPE0 | 33-85 | GHNSILSALREMPVVGGTGLFRFARGYALAKTYMVNATSHDAIVEYDVYVLHF |
| A0A6N2K7J7 | 545-597 | GRNQVFSTVREMPVIGGSGLFRFARGYVQARTHKVDLITGDATVEYNVYVFHY |
| A0A445CL16 | 137-189 | None |
| A0A2U1MPI4 | 439-490 | None |
| J3N6F8 | 18-71 | None |
| A0A7J6DV63 | 366-418 | None |
| A0A6D2HSL9 | 84-135 | None |
| A0A4D6M8E8 | 1-49 | None |
| A0A445CKZ6 | 20-73 | None |
| A0A438ELJ6 | 21-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.