DPCstruct | MC11030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 164 ± 11 aa |
| Standard deviation of domain lengths | 11.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 92.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A826GIU6 | 95-251 | VLGLDRSIPADIIDNDGLAQFDPEQDALDFWESVEGMVVAVDDAKILGPLKNKEIYVTPATSQLPLNNVGGVNLRPEGNNTNIIPLL… |
| G5K411 | 1-165 | MLGKDRLAPKDIIDNNGLSLFDPQEDAIDFWESMEGMLVAVDNAKAVGPMKHSEIYVLPGTSNRTLTNSGGVLLQPSVYNTDIIPIL… |
| A0A0K1S0E8 | 12-182 | None |
| A0A4S4M5P9 | 731-885 | None |
| J7LEB9 | 358-487 | None |
| A0A844MIJ4 | 443-606 | None |
| A0A4Y8LCQ5 | 630-801 | None |
| A0A0C9V5Z2 | 127-312 | None |
| J7SCK0 | 344-498 | None |
| A0A4Y9Z3L5 | 415-584 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.