DPCstruct | MC1103
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 326 ± 43 aa |
| Standard deviation of domain lengths | 42.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0101- CL0533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A355UPS1 | 73-409 | ALRVFAQLAEELDPFDSTNKGFFRGEEAFLPTVQGWRRWSKPSPEPELGEDFQRILLSSIQREGPKISWLIEELADQVQKSLKKPPL… |
| A0A543D467 | 2-302 | QLYRSALAAGAPRLARAVATVAELVLAERGRDVVLVSLARAGTPVGVLLRRWARHAHGLDLPHYAVSIVRGRGIDRLALHHLAAHHD… |
| A0A6P1EUF6 | 80-435 | None |
| S4MVI3 | 218-580 | None |
| D4L2P5 | 2-214 | None |
| A0A3M3RFH5 | 108-459 | None |
| A0A3M5MMM7 | 2-263 | None |
| A0A1G8UIL2 | 478-826 | None |
| A0A127A4M0 | 532-886 | None |
| A0A3M5I4V2 | 53-363 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.