DPCstruct | MC11029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 202 ± 23 aa |
| Standard deviation of domain lengths | 23.07 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20874- PF11083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0SIQ1 | 100-301 | QIDHVTTKGLYINVDFGLSQHGVIFIGAYKTDLLEDGNYNLYLKTNDYFYFIDMAGAANNRFMMGPTLMRQLSLYNGTVPIAKEKVI… |
| G5K2G3 | 33-253 | QVEQESSHGIYLQMDYGALNSGTVLIPSHKVDKQEDGNYIIYIKERDYFYFLNPDQSEKNRYMMGKTLARQLAKQNGEVLVTKNPHI… |
| A0A6G6AUU0 | 194-418 | None |
| A0A0F2DCA2 | 13-199 | None |
| A0A8B6L8H9 | 1-191 | None |
| A0A848MWA1 | 7-166 | None |
| A0A123VU81 | 194-361 | None |
| A0A7G1JIA3 | 4-227 | None |
| A0A4U9Z5P5 | 235-462 | None |
| A0A837SXU9 | 249-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.