DPCstruct | MC11028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 62 ± 6 aa |
| Standard deviation of domain lengths | 6.12 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 39.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G5K128 | 1-65 | MKEKCGAKKTSLKELPKISDRVSFIYVEHAKINRTDSAITVADSRGIVRTPAAMIGVLLFGPGTD |
| R8VZB1 | 1-53 | MKNLQELPKLKDSISYLYVEHAIIEQNDAAIIAIQKNGRTPIPIAAMTCLLLA |
| A0A426QB08 | 3-67 | None |
| A0A497BFW7 | 1-63 | None |
| A0A1H2KBV3 | 232-302 | None |
| A0A0F9EKS3 | 1-62 | None |
| A0A3L8RFR1 | 1-62 | None |
| A0A3C1YZH3 | 3-51 | None |
| A0A1C5MZB5 | 1-65 | None |
| A0A829LWI9 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.