DPCstruct | MC11027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 109 ± 12 aa |
| Standard deviation of domain lengths | 11.69 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 23.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A813G5R8 | 27-134 | GSTVFAVSDSSGGSTFEMVCAALKQFPRNGVDAVTLCPEVASLEAINHIVQEALLLESLIVFTFASPGMSRFMRQQCERAKVPYADV… |
| G5K009 | 3-96 | DQLTIFIISDSLGETARALAKACIYQFPNHDNWEFRCFSYINSPELLDKVFEEASQQTAFLMFSLVNEELASYAEMRFRKEGFAYVD… |
| A0A090S0Q3 | 3-104 | None |
| A0A847JJV6 | 1-117 | None |
| F1T6E0 | 14-122 | None |
| K9ICY3 | 3-86 | None |
| A0A835R310 | 160-257 | None |
| A0A3M0BWP4 | 18-116 | None |
| A0A484X3T5 | 1-109 | None |
| A0A7S0TRJ3 | 69-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.