DPCstruct | MC11026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 4 |
|---|---|
| Mean domain length (aa) | 90 ± 6 aa |
| Standard deviation of domain lengths | 6.16 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A386RDV3 | 1-100 | MGYHFATFSSNASLAKSEAKYAVSSAKALGLPKGSYLACDYETGSGNIITNCKNVTAKAILAFMDEIKAAGYQPLLYASSSVLQNNI… |
| A0A7U9T7G1 | 109-198 | YFYTQAVTEKEAEEEAEFVLDLIEDYDISYPVVLDLEETGSDTARTAEMTKEEYTKAAVAFCKTIQSAGYTPMIYGNLKTFMIMLDM… |
| R6D312 | 2-87 | None |
| A0A1C5RZF8 | 59-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.