DPCstruct | MC11025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 157 ± 16 aa |
| Standard deviation of domain lengths | 15.92 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 21.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12685 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A101XW48 | 1-115 | MFTNYLFEREQQNLKNYNDLIAQINDMSKTPAENAVAQEQLSKLEEKESKISDIETQLQQKYGEAIVKEETGNSYTVVVLSDKLDVK… |
| A0A352PNA8 | 7-156 | AFISVFTLGLVLSVYYAFIPKGGNDKPVNATVTAPVDPTKSYFNDLAKMREDNHSKNLGTYEASLQDSTEQEKAVILQKIEEEQKVM… |
| A0A373BIJ6 | 43-197 | None |
| R7L5V8 | 83-233 | None |
| A0A3D2CM78 | 120-284 | None |
| A0A357R2E5 | 1-135 | None |
| A0A3A4U845 | 86-254 | None |
| W7Z6C8 | 10-182 | None |
| A0A2V2FWL9 | 7-153 | None |
| A0A2V2FB07 | 178-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.