DPCstruct | MC11024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 313 ± 73 aa |
| Standard deviation of domain lengths | 73.33 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 29.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Q9W6M4 | 2-280 | LLFEPLPKELNRSIEPPANENVLQGPLDSFIEDMSTNIGIVRKKVSSAQLSVKTYTVGSDQKKKLSIVYLDDRADKGVIKKIISHIE… |
| A0A351SR42 | 8-352 | TDSQNIYNFIIRPVREYLNEHKKIKDLEPILAGPKLEKLKKIDDVFYYLENGFVVVIYKDDIFTSEIKADIDRGITMSQTEPNMYGP… |
| J3AWP1 | 16-284 | None |
| R6Y759 | 63-414 | None |
| A0A2C1C624 | 2-401 | None |
| A0A7Y0L2F0 | 2-270 | None |
| S0FXJ1 | 114-538 | None |
| A0A7U3ADC7 | 54-451 | None |
| A0A5C8MC43 | 5-299 | None |
| A0A0S2SA15 | 33-359 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.