DPCstruct | MC11023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 672 |
|---|---|
| Mean domain length (aa) | 151 ± 28 aa |
| Standard deviation of domain lengths | 28.43 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 13.20 |
| Pfam Score | 77.10 |
| Assigned Pfam label(s) | PF02342- CL0093- CL0128- CL0072- PF00239 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A351J3G8 | 5-135 | TVGTGQVRIVLSWGAEPRDLDSHLWTPSDYHVYYGDEGAADASPWAWLDVDDVTSYGPETITITSVQSGTYYYSVHNYSGEHPLSQS… |
| A0A2M8IUS9 | 18-145 | AERRMEERGGSRGDLNFTLEWSTTDDIDLYVTCPTGATVSYLNRGDCNGVYDLDANVLRAEAISDPVENIVFTDAPNGLYQVRAHLK… |
| A0A819S0W3 | 101-286 | None |
| A0A538Q0Q7 | 42-198 | None |
| A0A1G2VM76 | 28-158 | None |
| A0A1G6Y459 | 6-183 | None |
| A0A7Y5SGY9 | 464-603 | None |
| A0A2G4ILR0 | 206-344 | None |
| A0A820IVI9 | 13-134 | None |
| A0A2P8EPB3 | 546-689 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.