DPCstruct | MC11016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 86 ± 7 aa |
| Standard deviation of domain lengths | 7.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.79 |
| Pfam Score | 87.30 |
| Assigned Pfam label(s) | PF02772- PF02773 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834QDW8 | 277-361 | MQDRGAVLPIRVHTIVVSVQHDEEVCLDEMRDALKEKVIKAVVPPKYLDEDTIYHLQPSGRFVIGGPQGDAGLTGRKIIVDTYGG |
| A0A2U3XUA5 | 11-101 | QDNGAVIPVRIHTIVISVQHNEDITLEDMRKALKEQVIKAVVPAKYLDEDTIYHLQPSGRFVIGGPQGDAGVTGRKIIVDTYGGWGA… |
| W4U371 | 4-104 | None |
| A0A7V6GMH7 | 85-160 | None |
| A0A4W3JFH1 | 165-250 | None |
| A0A5E4BJZ2 | 268-343 | None |
| A0A5N5MBB6 | 899-981 | None |
| A0A507FFG9 | 436-519 | None |
| F0WA18 | 186-269 | None |
| A0A183J7P4 | 204-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.