DPCstruct | MC11015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 190 ± 24 aa |
| Standard deviation of domain lengths | 24.28 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.40 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | CL0125- PF09769 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A165YBE4 | 2-188 | SGQKLPIYPLPEREIVVVEQTSALEEHIGVARRHVQALYADAYGQVHGVVSRWIEVEHSIERRIKSLHAPDEQLNPGLLYIGVAALS… |
| A0A2U3XL15 | 4-184 | VIQRSVGPASLSLLTFRVYASPKKDSPHKTSVKVNELSLYSIPEGQSKYVEEPRTPLEESISHLRHYCEPYTSWCQEMYSQTKPRMQ… |
| A0A3Q3W7E1 | 9-199 | None |
| A0A1E4T1T0 | 22-236 | None |
| A0A2A9NFC9 | 14-214 | None |
| I4Y5K0 | 1-182 | None |
| A0A0F7SKQ0 | 16-215 | None |
| A0A4W4FWL4 | 83-277 | None |
| A0A817BTX7 | 5-172 | None |
| A0A4C1TN84 | 40-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.