DPCstruct | MC11014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 96 ± 12 aa |
| Standard deviation of domain lengths | 12.38 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 23.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14230 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I7Q632 | 71-146 | TVDKAQVATAISDNITQQFGTKPQSVTCPDNLKGVKGATLRCKLVTAEGQTYGVNVSVTGVDAGTIDYHFVVDEQP |
| A0A0F9DYW4 | 3-94 | RMAIVPLIVLGAVLAGCTSQLDTDKAEREIKKGIAEQTGVEVKSVECPDEVETEEGDTFECTAVAESGDEVSVKVTQTDDEGNVNWE… |
| A0A1Q2TXM6 | 18-116 | None |
| A0A147ENE6 | 2-87 | None |
| A0A838LIL3 | 1-81 | None |
| A0A1Q9S574 | 466-557 | None |
| A0A524JDX8 | 1-114 | None |
| A0A4R6PIU8 | 53-141 | None |
| A0A126Z5F1 | 121-217 | None |
| A0A6G7Y6J9 | 40-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.