DPCstruct | MC11012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 73 ± 8 aa |
| Standard deviation of domain lengths | 7.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 51.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P2T1L6 | 112-179 | PIPMLLFCPACGLQHVDAPEPAHDGEEEWDNPPHRSHKCHACATVWRPADVPTVGVASIQTSGQADNW |
| A0A0F9DN09 | 1-67 | MPGDTIANIAMLLWCPGCGERHIDKGKFATKPHHTHACQQCGLAWRPAIVDTVGVQFLPGFKDEEPA |
| A0A7W6Z6N7 | 217-295 | None |
| A0A248VXY1 | 39-110 | None |
| A0A808WCH0 | 106-190 | None |
| A0A7Y5NMZ3 | 2-72 | None |
| A0A6P2GFW9 | 109-192 | None |
| C6BPI3 | 44-116 | None |
| A0A1T5CV79 | 25-84 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.