DPCstruct | MC11010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 55 ± 5 aa |
| Standard deviation of domain lengths | 5.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433RUI2 | 7-59 | DVEDLRDYCPMCIQLLRFSDDYDALYCATCNEWVEVTCDDPTCEACERRPEKP |
| B9MPY7 | 26-82 | ISQIEMGSVTKLCPFCLSESLYNYQYDAYYCERCNIWLEPKCEDDSCEFCKNRPLRP |
| A0A1V5LW78 | 27-77 | None |
| A0A2F0AU50 | 11-73 | None |
| A0A0F9KQ69 | 28-81 | None |
| A0A0J1FFU4 | 1-63 | None |
| A0A502CHY0 | 6-60 | None |
| A0A1Q2L0C7 | 48-97 | None |
| A0A1D8JKK4 | 29-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.