DPCstruct | MC1101
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 94 ± 8 aa |
| Standard deviation of domain lengths | 7.91 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 20.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J9W3L3 | 1-76 | MPVDDEPHEIALTGPIVHIGSRRIDEVEVWFEHHNGHVPVLHDVRVFGTGHAVPDGARHLGTAIEPSGALVWHLYS |
| A0A516P4L4 | 1-88 | MTTIHKYTIPYEFNELSIPEGAEILSMQLQNGIPCIWVMVDTDQPKIKRKFMIVGTGKELHPCVLHTFIGTYQLNEKGLVFHVFEIPM |
| A0A0Q4N0R6 | 1-104 | None |
| A0A1S7DU47 | 91-178 | None |
| A0A260WF50 | 2-97 | None |
| A0A1X1U5Q0 | 12-101 | None |
| A0A2W4V3A1 | 2-92 | None |
| A0A495LV22 | 2-95 | None |
| A0A7Y9DWM0 | 2-98 | None |
| N6WWN0 | 1-93 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.