DPCstruct | MC11005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 237 ± 23 aa |
| Standard deviation of domain lengths | 22.52 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 12.94 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0U5E7U1 | 10-252 | TREIVEQLQALSGYPVSYFEDGSLRTNATLQIGTPANPVHLIRYQPGRGSPDYWIAFEAGNAIRLFRHQAERRFRLSGSSAYRDQVA… |
| A0A1V4X9V4 | 29-282 | GLLDPVRDILETLCTVSGKGIRAVRKPDLKSLARLRMAGPGSQEHVLFHRGGDDPLVNHVIANECGHLIRLLAAPPDMRMVAVANER… |
| A0A3D3QSA3 | 20-251 | None |
| A0A7V3UL61 | 22-250 | None |
| A0A352N9D3 | 96-326 | None |
| A0A1F8MS39 | 342-574 | None |
| A0A1V4VY00 | 51-286 | None |
| A0A1W9VNA9 | 150-399 | None |
| A0A5K7SAI1 | 159-411 | None |
| A0A255SSI7 | 111-357 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.