DPCstruct | MC11001
Metacluster Properties and Pfam Annotations
| Number of structural domains | 97 |
|---|---|
| Mean domain length (aa) | 118 ± 20 aa |
| Standard deviation of domain lengths | 20.37 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 29.50 |
| Pfam Score | 61.03 |
| Assigned Pfam label(s) | PF12911- CL0404 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7K4ECN7 | 6-127 | VVLLALFGPWLAPHAPTDMLGGVYGAPTAGAPLGHDFLGHDVLSRLLAGGLSILWMSVAAASLALIVGSALGMLAGLSRQRLDQAIT… |
| W9VJV0 | 7-106 | RLRSSQWLGLALILSLLIFAVLEGWLHSGHYATQNLANYLMMPNAQEWLGTDQFGRSMMARMGSAIRLSFLLSFFCVLTSVLLGSFL… |
| A0A7J9ZT93 | 1-93 | None |
| A0A2A2K5X3 | 616-722 | None |
| A0A135VMM9 | 172-317 | None |
| A0A7R6YSJ4 | 10-132 | None |
| A0A6J4TPM2 | 2-137 | None |
| A0A0K2RIE4 | 2-115 | None |
| A0A7V3K4M5 | 403-509 | None |
| A0A0B8PJ48 | 3-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.