DPCstruct | MC11000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 99 ± 12 aa |
| Standard deviation of domain lengths | 11.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0344 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W9V1G4 | 1-95 | MNQIPVKDVTPKSSKDNVQTFDMYAKREHIYVKYYKGFFKNLRTFTGFVLLALFFGVSWLQWDGRQAVLFDLPNRQFHVFGMTFWPQ… |
| A0A3B0Z893 | 19-88 | EEPHHVNVGGQTIHAKRMGGRFRQYKDLVWLFWISYLLLPFLRVNGEQIVLFDIPARQFHFFGATIYPQD |
| A0A0A8RA80 | 247-356 | None |
| E4PM85 | 1-98 | None |
| W9TWP2 | 1-103 | None |
| W5YLF5 | 1-109 | None |
| A0A090SI25 | 1-109 | None |
| A0A2K9F8I2 | 1-97 | None |
| E2XWD4 | 1-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.