DPCstruct | MC1100
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 127 ± 21 aa |
| Standard deviation of domain lengths | 20.99 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 84.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 36.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A074W9X3 | 1-106 | MYSGNGTVAAGWPAQNAWVDFNSMFTANIPIMQQSCANNGWGANNSPDEIADIKSSILKVSASSGVDARFILAIVMQESNGCVRVVT… |
| A0A2J6SII7 | 1-114 | MGFTWYSGPASSFPPMSTWKDFETIFNLNKAEMLQTGDSGEDVGRIWNAVLEAAKLGVEERVIFCIIMQESTGNVGVGTPNDMDNNP… |
| A0A3M6ZEF9 | 384-544 | None |
| A0A1Y6LZC3 | 3-114 | None |
| B0XST0 | 780-918 | None |
| A0A6A5Z4P8 | 2-146 | None |
| A0A1X7S6W8 | 12-134 | None |
| A0A2J6SBE8 | 239-332 | None |
| A0A6A6T2L7 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.