DPCstruct | MC110
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 102 ± 13 aa |
| Standard deviation of domain lengths | 12.55 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 48.58 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0292- PF01063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166HVY1 | 464-559 | DKVPLLSGSEAIERMRTNRESYKSKQQYMAMYSSCFGGITTDPAAMVIPLDDHMVHRGHGVFDTAAIVNGCLYELDQHLDRFLNSAK… |
| A0A813EEJ3 | 1-111 | MAENGQRPSKHALPVLNEQAFIERSKRARLKRNPEGHFIHAMYSSLVDGIVTDPELMVLPLDDHSIVRGHAVFDTATLSKGRVYRLE… |
| A0A0A9JBZ8 | 1-76 | None |
| A0A6A1UVE1 | 8-107 | None |
| A0A200QM05 | 9-119 | None |
| A0A2P6PSN4 | 26-128 | None |
| A0A835S8D7 | 45-156 | None |
| A0A835P6J7 | 1-103 | None |
| A0A0B2WPV5 | 30-152 | None |
| A0A803QWF6 | 60-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.