DPCstruct | MC10992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 155 ± 14 aa |
| Standard deviation of domain lengths | 14.14 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 39.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C3NWW3 | 1-131 | MPPRRERKPWTLPPPPGPSLRQRVEQKEREQGLRCSDTSCGIGPSDDEPYPPLSHLSMKEVSIHKQVDGAIVTSGAVCAHKFHPACL… |
| A0A0D7BJ99 | 257-392 | FPMQTFVGAPPPSTRPRMPRERKKWSLPPSPGLSLREKVEKREREGGLRCDDMSCGVAPSDDDPDITVDEKRILIHRSEGGHTCAHK… |
| A0A0C9WFZ2 | 29-186 | None |
| A0A165GKP9 | 404-550 | None |
| A0A5C3QH29 | 1-160 | None |
| A0A1Q3EDJ7 | 1001-1184 | None |
| A0A067Q6Y4 | 881-1040 | None |
| S8EMG0 | 631-782 | None |
| A0A427Y384 | 486-648 | None |
| A0A4S4LSF1 | 750-909 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.