DPCstruct | MC10991
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 205 ± 22 aa |
| Standard deviation of domain lengths | 21.60 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 21.18 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A060S3E3 | 1-199 | MSTGVGMEGGPVPIERQQLPIYIDKVANALRLNVQYRAELHAFKELVLDLPPYLWRTTIYQQASIYRSLQLNEEGQESVAGIKADIK… |
| A0A0C3NHC9 | 1-205 | MILRRNNAMTTTVLGSHPTPVSRQSHARKDFKLWAQKVASKFELKAAQFLELSTFINVGRKLNATDLRLRIWQQATSYKILNGIEEI… |
| A0A2H3BZ22 | 15-212 | None |
| A0A1M2W0M5 | 2-253 | None |
| A0A5C3KKN1 | 1-174 | None |
| A0A5C2S0H7 | 3-209 | None |
| A0A5E3X3I1 | 694-895 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.