DPCstruct | MC1099
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 169 ± 32 aa |
| Standard deviation of domain lengths | 31.68 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 36.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A848FDJ6 | 2-130 | AARGIQAGWDFLRDAAGFDIGESLIAFDAGQSYGRAFLVGVLNTLRVALAGIATATLLGMAVGIARLSRNALLSGLAGLYVEVIRNV… |
| A0A6D0M3I2 | 3-158 | YLIHNTVTNLNNRGITSGFAFLDRSAGFGIVQHLIDYQEGDTYGRVFIVGLLNTLLVSALCIVFASVLGFFLGLARLSENWLLRKLS… |
| A0A399Z2P1 | 165-349 | None |
| A0A6M7GS77 | 1-194 | None |
| A0A2M8PX27 | 2-193 | None |
| A0A366E4C6 | 3-209 | None |
| A0A4Q3JKG4 | 2-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.