DPCstruct | MC10989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 323 ± 51 aa |
| Standard deviation of domain lengths | 51.01 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 70.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.28 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D6RQS8 | 18-286 | RGNRKPNIPRGNFEEVNARCQRAQEEGGKIKATIDSYLGHIRRAQGWLAPIVAEEKRRAMEWEMEKTQHCINEAPTTGRKSAMPEDM… |
| A0A0C3ND02 | 50-360 | SHDMVQKWINEAVAGSGIPGKAALTRPASTKALNMAHASLTADMASLHTTMKEVCQQLSDMSNLVVKALTSPSTYLAQPETVSHQVM… |
| B0DEI5 | 383-665 | None |
| A0A409WUU4 | 814-1181 | None |
| M2QG18 | 95-440 | None |
| A0A0C3D4J5 | 348-793 | None |
| A0A0C9YWD9 | 56-417 | None |
| A0A0C3I997 | 357-649 | None |
| A0A0C2ZHQ4 | 2-269 | None |
| A0A1Q3EGZ9 | 10-267 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.