DPCstruct | MC10984
Metacluster Properties and Pfam Annotations
| Number of structural domains | 152 |
|---|---|
| Mean domain length (aa) | 74 ± 12 aa |
| Standard deviation of domain lengths | 11.61 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 26.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C2Z823 | 22-86 | PLGKHIVSAKGVCGGRPTFKYTRVEVRHVLDLLAHGWTIEQIVRDFNRPEIHPEAIEEALRLAAK |
| H5SUE3 | 5-78 | LKKTEHPYIVRHPRVCGGSPVIRGTRITVWLLAALLRGGATPEEIMRTYPHLEPAQVYDALSYYFDHRREIDRE |
| A0A519TJR9 | 35-96 | None |
| A0A418LWC1 | 2-63 | None |
| U1PRS1 | 9-103 | None |
| A0A5R8Q9Y1 | 70-139 | None |
| A0A7K2AK13 | 4-114 | None |
| A0A4V2SYA3 | 53-125 | None |
| A0A7U3ZJ49 | 28-98 | None |
| A0A7J9THI0 | 3-57 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.