DPCstruct | MC10983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 189 ± 23 aa |
| Standard deviation of domain lengths | 22.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 13.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2R3HEV7 | 162-339 | RYGLDSFTFEGTLPAEFGMDIMPSYDPVDPESSVCQRQNLYGEWSPRYYGTSDNIPIQAQPQSFKHKVPLTYSVGLCRMQLTSVDLD… |
| A0A833MT89 | 24-207 | PMLYLWGNSIEVEINTPAHLVPSVGGSYSSSSCQSLSMSSGNWIDERRGGDAKLEKISDTQYRAKVYYQDFGPCNWQLDSVGWTLEY… |
| A0A2L0RUF9 | 12-201 | None |
| A0A5A9D0Q5 | 4-191 | None |
| A0A1B9JYN9 | 12-233 | None |
| A0A0G3CMH1 | 14-190 | None |
| A0A7Y6ZZ09 | 6-158 | None |
| A0A6J5BLR0 | 98-269 | None |
| A0A3B9ZZS7 | 33-213 | None |
| A0A2G2HZX8 | 12-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.