DPCstruct | MC10981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 75 ± 5 aa |
| Standard deviation of domain lengths | 4.65 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C1AG11 | 56-120 | VRKTYSASEIGDELGVSANKIGRLANKHNLKTNEYGMEVLDQAKHSHKQVPSFRYFENVKPVFRE |
| A0A379CNU0 | 12-83 | VTQQHWRATDIAKELGVSAQKVGRIANQHGLKKAPYGEWRLDQATYSQKQIESFVYNAKGRQALHELFRTNH |
| A0A3S0D8D1 | 296-368 | None |
| A6GGE8 | 179-254 | None |
| A0A0F7JB91 | 2-73 | None |
| A0A2R7QCD1 | 46-123 | None |
| A0A777DKL9 | 110-184 | None |
| A0A198GD74 | 147-221 | None |
| A0A143Q369 | 72-147 | None |
| A0A128EYE2 | 54-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.