DPCstruct | MC1098
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 99 ± 17 aa |
| Standard deviation of domain lengths | 16.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 89.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Z8LF97 | 3-97 | KKTIEDWQALAEKELKASPDTLTWQTPEGIAVKPLYTADDLADVGHLESLPGFAPFTRGPRATMYAGRPWTIRQYAGFSTAEASNAF… |
| A0A2X2I0B4 | 1-96 | MSNVQEWQQLANKELSRREKTVDSLVQQTAEGITIKPLYTEADLDNLEVTGTLPGLPPYVRGPRATMYTAQPWTIRQYAGFSTAKES… |
| A0A450XY86 | 15-142 | None |
| A0A7X7LHW0 | 4-109 | None |
| A0A0Y1BXU3 | 10-131 | None |
| D0MU49 | 2-68 | None |
| A0A371SHF4 | 1-77 | None |
| A0A6G3UZZ2 | 3-115 | None |
| A0A1Q9V436 | 12-118 | None |
| A0A450T468 | 13-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.