DPCstruct | MC10974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 106 ± 8 aa |
| Standard deviation of domain lengths | 8.28 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 80.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03755 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M5WVB7 | 9-103 | ARVERAGAQGTLSWELRSVNHRYLEPHLRLPESFRDLEGAIREALRQGLSRGKVECTLRFVEETAGKLDFAGLQAGYTQFFGTPEQP… |
| A0A2V7UY23 | 6-117 | TGYGSAAAESAALRATVTVRSLNHRFLELIVHLSRRLLPLEREIKDLVQSCLSRGRVEVSVQASFPAAETGDVVVASRPLVASFVRT… |
| A0A1F8JKY5 | 1-105 | None |
| A0A831ZL24 | 138-251 | None |
| A0A3C1NGB9 | 6-112 | None |
| A0A3B8UW18 | 2-106 | None |
| A0A136K8F9 | 1-108 | None |
| A0A534PX63 | 1-112 | None |
| A0A1Y1HT03 | 217-323 | None |
| A0A517T0D0 | 49-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.