DPCstruct | MC10973
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1227 |
|---|---|
| Mean domain length (aa) | 157 ± 29 aa |
| Standard deviation of domain lengths | 28.52 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.40 |
| Mean intra-cluster sequence similarity (%) | 11.40 |
| Pfam Score | 37.23 |
| Assigned Pfam label(s) | PF19929- PF14504- PF11006- PF03676- PF19818 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V7UTP1 | 20-168 | LMVPSGCAGQGDIQPGVGAAGIRLGDGRNAVEKVLGRPESTNTSAVHGSRNVETTYLLYPSKGLDVLLEGDKVRSVFLYSEGVDEHK… |
| R7FTE9 | 5-133 | FGVGACGVLFGMTPKDVVNVLGMPDKINVCEDDEIYGQTYIYNREMMMVWFEREKDMRVTLIQCFSPEMTVFGKKVFLREKDDVMRL… |
| A0A1I0E562 | 56-242 | None |
| A0A4V2W3K3 | 1-142 | None |
| G8SGM9 | 23-149 | None |
| A0A6L7GTG0 | 2-170 | None |
| A0A1Y6B9E9 | 132-296 | None |
| A0A1T3NID3 | 9-117 | None |
| F4QB45 | 116-298 | None |
| A0A522UH99 | 172-314 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.