DPCstruct | MC10972
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 131 ± 11 aa |
| Standard deviation of domain lengths | 11.25 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.27 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C3J8W4 | 3-139 | PHKHAIISATVGVIGWWATGKPAAGVAALATGVLPDIDHFIDYSYYRWRKEHRLILPLHGYEFALLATVMALLKGDKVLGIAALSYL… |
| A0A0F0CVD0 | 23-153 | LLSHVILASLFSIFFYVVTHKISWVFLCILGGIFIDIDHFIDYFLYYGRNFRLGHFCYCRYLDSGKCYIFFHSWEFILLLWIGAFFI… |
| A0A7X7DXK4 | 1-139 | None |
| A0A1F9WX61 | 2-120 | None |
| A0A521TR85 | 4-134 | None |
| A0A355B436 | 1-142 | None |
| A0A535XFN5 | 4-130 | None |
| A0A7X7J8Q7 | 1-117 | None |
| A0A7C4SUR3 | 20-165 | None |
| A0A7V3XJF0 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.