DPCstruct | MC1097
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 192 ± 19 aa |
| Standard deviation of domain lengths | 19.41 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 36.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0125 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1U7NXQ1 | 23-235 | AADRDRDGYPDAAELVGQDRANFADWFAAVAESQYYGMNADWKPEDRDCGGLLRYAFTNALMPHDAAWFAKFRYLPRPKLGPVQAFS… |
| A0A1S9JL30 | 18-204 | HSEMLNVEQSGLFRAWFVCIAQEQLRQGPSPRWYQQDCAGLVRFAANETLKVHDSKWLKSNGLSSQYLPPEMTLTPEQRQLAQNLNQ… |
| Q32DW1 | 18-182 | None |
| A0A1H1H4R0 | 76-276 | None |
| A0A838MXI9 | 2-194 | None |
| A0A660QCH0 | 113-318 | None |
| A0A7G6AAX5 | 2-172 | None |
| A0A7C3I048 | 22-207 | None |
| A0A7G1G5C5 | 37-243 | None |
| F4VHJ8 | 27-213 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.