DPCstruct | MC10969
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 165 ± 15 aa |
| Standard deviation of domain lengths | 15.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.78 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06854 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4J2BTI2 | 1-148 | MTRLEQAQLIVHLLTGQELYDIKEVVDCWIYIKEHFLGIEKETVQYDLLGNPMPKAKGEEEQEKLIDFEQDAEYIYASFLQAYGINL… |
| A0A6G7Y2S6 | 14-163 | NGEYYPINTSYTVGLRCMSLIDSDVSPKERTYGVLTMLFGKDAPKDVFMLDKAVLYLQRGEELEVQKTRVHDIDIVQDLPLIAISIE… |
| A0A2V2F235 | 60-211 | None |
| A0A837R9J9 | 3-160 | None |
| A0A1M4TR02 | 12-191 | None |
| A0A391NYT6 | 10-170 | None |
| A0A3E4QP02 | 22-209 | None |
| A0A374U4A5 | 215-398 | None |
| A0A1I3QPX8 | 3-153 | None |
| A0A7H9ED25 | 20-205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.