DPCstruct | MC10968
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 71 ± 3 aa |
| Standard deviation of domain lengths | 3.49 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 38.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4LRP8 | 2-75 | KLEYITPVVGTVYRNRNGNLYLCTSVEKRPMPCETTATFQRIPDGWTLTAHGIMQYESDEEIVWGYSVNGHWPP |
| A0A3D0M0J0 | 1-68 | MDSYVELTAGTVYDQSNGDQYKCLGKTESGTLMERVSDGWMLVAHGTRQDEHGLICWNYSTGGHWPDK |
| A0A1V5GC37 | 98-172 | None |
| A0A843GX48 | 43-111 | None |
| A0A2N0KDF6 | 41-108 | None |
| A0A3A9A5H6 | 1-71 | None |
| A0A7G8TD72 | 152-224 | None |
| A0A1G4X0L6 | 2-71 | None |
| A0A6N8HXM3 | 66-135 | None |
| A0A3A8YXG3 | 57-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.