DPCstruct | MC10966
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 170 ± 29 aa |
| Standard deviation of domain lengths | 28.59 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 82.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09560 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6ET82 | 3-120 | NKLLLEFSQNAEETYSLSDRKEHKVNLGVITGSRILSQLPIYIKIKVQPLSLTKFQYETEFETEGINQTRYYIYCTVTSQVHILAPF… |
| A0A3C2DV03 | 4-163 | ANKAVAKVLTESGITYDEIVKTERNAEGNVTSLCVDTVKINILQSGITLAVSEITAENETFVISIPLGTFLGSEYTNGYGPRVKFNA… |
| A0A7C6SC68 | 1-134 | None |
| A0A1K2C2Y0 | 30-198 | None |
| A0A226BX23 | 22-227 | None |
| A0A3D2D4Z6 | 34-221 | None |
| A0A229P5M0 | 232-409 | None |
| A0A7C6KK36 | 66-253 | None |
| A0A7X7SXR8 | 51-214 | None |
| A0A7X6VG44 | 9-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.