DPCstruct | MC10965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 59 ± 4 aa |
| Standard deviation of domain lengths | 3.85 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H3TTK2 | 1-63 | MNQEDINYFYEKYGQPIDKIEVTEDIIKKYQGKLPESILEQWRLFGFAGYLNGLYWITNPDDY |
| A0A3C1CWE5 | 2-65 | LLNTVALQDFQSYAKVNDNVINKFKNKIPETLLKIWQNYGLGTFMNGYIKVINPDDYQSIIDNT |
| A0A164NKA0 | 4-60 | None |
| A0A7X2D3Y6 | 4-61 | None |
| W7C700 | 2-57 | None |
| A0A024QCV8 | 4-57 | None |
| A0A024QI11 | 3-61 | None |
| A0A3M5TGL9 | 1-65 | None |
| A0A374UNE9 | 16-79 | None |
| W1J421 | 3-64 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.