DPCstruct | MC10964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 95 ± 14 aa |
| Standard deviation of domain lengths | 14.46 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.49 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5QH50 | 18-128 | NFPFPSTRYQGSKWSLVDWIWENLYPLRFDTVLDVFGGTGVVSHMFKNAGKQVIYNDYLTFNWNIGLALVENRGIVLSEYDIETIVT… |
| A0A3C1CTA5 | 12-99 | TSLINNRRYLGNKYKLLPFITKVVNEECSDIDSVADIFAGTGAVSSAFTEKLLITNDLMYSNYICNYAWFGAESYDQQKIIDYVVRYN |
| A0A239WWN0 | 60-153 | None |
| X1I948 | 73-164 | None |
| A0A809NLB1 | 1-84 | None |
| A0A1D2WBQ8 | 1-135 | None |
| A0A649Z3K0 | 9-90 | None |
| A0A6S6R3V7 | 66-149 | None |
| D9PF45 | 42-126 | None |
| J9USE1 | 4-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.