DPCstruct | MC10963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 183 ± 42 aa |
| Standard deviation of domain lengths | 42.17 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 91.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 24.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18318 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3C0X1Y4 | 43-245 | IIKETVKAHKRIIFNGDGYSDDWQAEAQKRGLLNLKSTVDALPLLKSEENIAMFERHGVLSRAEINSRVDIVLENYCKVLHIEALTL… |
| A0A812SIK1 | 449-593 | PKAIATWSSEKNTKLLETLKIYTKEETEARQEVMYENYISCICCEVETMIQMVETGFLPACAKDLDKYKGVDKLTGSRKTVYENVVD… |
| A0A7X7H6S9 | 1-146 | None |
| A0A7V4PBH6 | 249-448 | None |
| A0A7S2VPI7 | 2-114 | None |
| A0A2H9TI80 | 543-775 | None |
| A0A7S2J299 | 1-127 | None |
| A0A5J4V191 | 229-404 | None |
| R6NM13 | 1-167 | None |
| A0A812V7I5 | 974-1181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.