DPCstruct | MC10962
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 317 ± 44 aa |
| Standard deviation of domain lengths | 43.63 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.47 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 23.25 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V2XN84 | 2-251 | EIKSPDKRPRTPEDEEPSKRQKLVLDTAPLDNVIPEPHLYPSGDNKAPDLKKLLSYAKSQPIPIHPHTLPISVSHVHSRRAWLIPVR… |
| A0A067PA56 | 3-291 | EWGTAVDDNEIYDIQELEEFHSHLTRREHSASSPPRRPPSPSQAEERPHKRLKVEAGSLFSWIPQPHIHTSPYRPRNATVTIHPFSK… |
| A0A0D0ARX1 | 15-355 | None |
| J4ICB9 | 255-658 | None |
| A0A165UJK3 | 4-301 | None |
| A0A0C9UGD6 | 57-400 | None |
| A0A0K6FLW2 | 801-1035 | None |
| A0A166I5D2 | 37-342 | None |
| K5VVG1 | 56-362 | None |
| B8PEM6 | 9-410 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.